PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG020006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family CAMTA
Protein Properties Length: 1081aa    MW: 121279 Da    PI: 5.2891
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG020006.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1178.86.6e-56201362118
         CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcy 99 
                  ++ ++rwl++ ei++iL n+++++++ e+++ p+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LK g+v+vl+cyYah+e+n++fqrr+y
  CCG020006.1  20 VEAQHRWLRPAEICEILSNYQRFRIAPEPAHMPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKSGSVDVLHCYYAHGEDNENFQRRSY 117
                  6779********************************************************************************************** PP

         CG-1 100 wlLeeelekivlvhylevk 118
                  wlLeeel++ivlvhy+evk
  CCG020006.1 118 WLLEEELSHIVLVHYREVK 136
                  ****************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143781.11315141IPR005559CG-1 DNA-binding domain
SMARTSM010768.9E-7718136IPR005559CG-1 DNA-binding domain
PfamPF038595.9E-4921134IPR005559CG-1 DNA-binding domain
PfamPF018331.7E-4503586IPR002909IPT domain
SuperFamilySSF812961.71E-15503588IPR014756Immunoglobulin E-set
Gene3DG3DSA:2.60.40.103.3E-4503589IPR013783Immunoglobulin-like fold
SuperFamilySSF484035.6E-15678794IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.205.5E-16682795IPR020683Ankyrin repeat-containing domain
CDDcd002043.90E-11689792No hitNo description
PROSITE profilePS5029716.547700804IPR020683Ankyrin repeat-containing domain
PROSITE profilePS500889.778733765IPR002110Ankyrin repeat
SMARTSM002480.011733762IPR002110Ankyrin repeat
PfamPF000235.4E-4733764IPR002110Ankyrin repeat
SMARTSM002483300772801IPR002110Ankyrin repeat
SuperFamilySSF525401.09E-7903957IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000152906928IPR000048IQ motif, EF-hand binding site
PfamPF006120.0045909927IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.206909936IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0039929951IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.597930954IPR000048IQ motif, EF-hand binding site
PfamPF006122.2E-4932951IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0010150Biological Processleaf senescence
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 1081 aa     Download sequence    Send to blast
MADTRRYPLG NQLDIQQILV EAQHRWLRPA EICEILSNYQ RFRIAPEPAH MPPSGSLFLF  60
DRKVLRYFRK DGHNWRKKKD GKTVKEAHER LKSGSVDVLH CYYAHGEDNE NFQRRSYWLL  120
EEELSHIVLV HYREVKQGTR TNFNRIKEHE ECIPYSQETE DTMPSSEMDT SVSSGFHPNG  180
YQVPTRTTDT ASMNSAQASE YEDAESVYNN QASSRFHSFL EVQKPAMEKI DTGSSVHYDH  240
MTFPSDYQGI LSAVPGMDFI SLAQVDKTKE TNGTESACEP QKVTDLPSWD DVLENGACGI  300
ESVPFQTLLS QDDTEGIIPK QDGILEKLLT NSFDKREDIG SHILDQEAWQ SMDGVSSHLL  360
KWSVDQKLLL DSGYDLTARF PDEQLDSGNL INTLEPLCTQ ENDILIQNDQ GMTLEGKPMY  420
SSLVKHHILD GSGTEGLKKL DSFTRWMSKE LGDVEPQVQS SSGSYWITVE SENGVDDSSN  480
PSQGNLDAYL LSPSLSQDQL FSIIDFSPNW AYAGTEIKVL IMGRFLKGRE AAENFQWSIM  540
FGEVEVPAEV IADGVLRCNT PSHKAGRIPF YVTCSNRVAC SEVREFEYLS HTQDITYNYR  600
DSVTEDLNMR FGKLLSLSSV SPSKYDSSSV DEILSSKINS LLNEDNETWD QMFKLTSEEG  660
FSSEKVKERL VQKLLKEQLH VWLLQKASEG GKGPSILDEG GQGVLHFAAA LGYDWALEPT  720
IVAGVSVNFR DVNGWTALHW AASYGRERTV ASLIHLGAAP GALTDPTPTY PTSRTPADLA  780
SANGHKGISG FLAESALSAH LSSLNLEKQD GKAAECSGTQ ASQTVSGCNA TPVNDADLPS  840
GLPLKDSLAA VCNATQAAAR IHQVFRVQSF QKKQLKEYGD DKLGMSHERA LSLIAVKSQK  900
AGQYDEPVHA AIRIQNKFRG WKGRKEFLII RQRIVKIQAH VRGHQVRKNY RKIIWSVGIL  960
DKIILRWRRK GSGLRGFKSE ALTDGSSMQV VQSKDDDDDF LKEGRRQTEE RSQIALARVK  1020
SMHQHPEARE QYCRLRNVVA EIQEAKAMWE WANNSEVMAE FDELVDLGTS MDDDSFMPSN  1080
S
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00042PBMTransfer from AT2G22300Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011022798.10.0PREDICTED: calmodulin-binding transcription activator 3-like isoform X1
RefseqXP_011022797.10.0PREDICTED: calmodulin-binding transcription activator 3-like isoform X1
RefseqXP_011022796.10.0PREDICTED: calmodulin-binding transcription activator 3-like isoform X1
SwissprotQ8GSA70.0CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBLU5G7F70.0U5G7F7_POPTR; Uncharacterized protein
STRINGPOPTR_0007s05410.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82842735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22300.20.0signal responsive 1